PRTODAY / NewswireToday Free press release distribution service network

Written by / Agency / Source: AnaSpec, Inc.

Check Ads Availability|e-mail Article


Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!

AnaSpec Introduces Sixteen New Catalog Peptides - This week AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced sixteen (16) new catalog peptides
AnaSpec Introduces Sixteen New Catalog Peptides

 

NewswireToday - /newswire/ - San Jose, CA, United States, 2007/12/18 - This week AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced sixteen (16) new catalog peptides.

   
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

[Cys17]-beta-Amyloid (1-17)- Cat# 62473
This peptide amino acids 1 to 17 is a modified fragment of the b-amyloid peptide; with cysteine substituted for valine at position 17.
Sequence: DAEFRHDSGYEVHHQKLC

[Cys24]-beta-Amyloid (1-24)- Cat# 62475
This peptide with amino acids 1 to 24 is a modified fragment of the b-amyloid peptide; with cysteine substitution for valine at position 24.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDC

Beta-Amyloid (1-16)-Lys(Biotin-LC)-NH2- Cat# 62136
This is the N-terminal fragment of the b-amyloid peptide; residues 1 to 17; biotinylated on the lysine side chain with 6-aminohexanoate (LC) as a spacer.
Sequence: DAEFRHDSGYEVHHQKK(Biotin-LC)-NH2

Beta-Amyloid (1-16)-Lys(LC-Biotin)-NH2- Cat# 62464
This is amino acids 1 to 17 N-terminal fragment of the b-amyloid peptide with 6-aminohexanoate (LC) as a spacer on the side chain of lysine; and biotinylated
Sequence: DAEFRHDSGYEVHHQKK(LC-BIOTIN)-NH2

Beta-Amyloid (1-28)-Lys (Biotin)- Cat# 62465
This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKK(Biotin)-NH2

Beta-Amyloid (22-40)- Cat# 62453
This is amino acids 22 to 40 fragment of the ß-?amyloid peptide. This sequence may be used in the ß-?amyloid structure and aggregation studies.
Sequence: EDVGSNKGAIIGLMVGGVV

Beta-Amyloid (25-35); biotinylated- Cat# 62451
This peptide is amino acids 25 to 35 fragment of the ß-amyloid; biotinylated at C-terminus. This peptide possesses many of the characteristics of the full-length ß-amyloid peptide; including an amphiphilic nature and an ability to aggregate; and can serve as a model system to study the conformational changes involved in Alzheimer's disease. Aggregates of ß-amyloid (25–35) have been shown to possess the neurotrophic and neurotoxic properties of their full-length counterparts and there is evidence that the monomeric form of the peptide may itself be cytotoxic.
Sequence: Biotin-GSNKGAIIGLM

Galanin Like Peptide (GALP); rat- Cat# 61847-05
This 60-amino acid rat Galanin Like Peptide (GALP) has homology with human and porcine GALP. GALP peptide was first isolated from the porcine hypothalamus; and then identified in other species including rats and humans. It shows GALR2-agonistic activity; and induces food intake. Studies show the importance of hypothalamic GALP in the integration of metabolism and reproduction.
Sequence: APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT

RAB38/NY-MEL-1 (50-58)- Cat# 62367
This is amino acids 50 to 58 fragment of the melanocyte differentiation antigen RAB38/NY-MEL-1 protein which is expressed in the vast majority of melanoma lesions. The immunogenicity of RAB38/NY-MEL-1 has been corroborated by the frequent occurrence of specific antibody responses in melanoma patients. This peptide exhibits a marked response in ELISPOT assays after in vitro sensitization of CD8 T cells from HLA-A*0201+ melanoma patients.
Sequence: VLHWDPETV

PB2 (198–206) Polymerase Mimotope- Cat# 62259
This peptide is derived from the PB2 polymerase (PB2198–206). PB2198 is a mimotope that can stimulate an IFN-gamma. response by highly activated PB1703-specific CD8+ T cells and is recognized by PB1703-specific CTL. It is not capable of driving either the clonal expansion of cells that bind the KbPB1703- tetramer or effector CTL generation following in vitro culture.
Sequence: ISPLMVAYM

Measles Virus Fusion Protein (421–435)- Cat# 62409
This peptide is amino acid 421 to 435 fragment of the measles virus fusion protein (MV-F). It is an immunodominant Ta; H2d restricted epitope; it induces MV-specific T lymphocytes in vivo.
Sequence: PVVEVNGVTIQVGSR

[pTyr429] Erythropoietin Receptor Peptide (EpoR); (423-438)- Cat# 62345
This is amino acid 423 to 438 fragment of the Erythropoietin Receptor Peptide (EpoR); phosphorylated at Tyr429. It binds to the N-SH2 domain that has a function in regulation of the PTPase domain and thereby signal transduction. It activates SHP-1 (previously called PTP1C; HCP; and SHPTP1); a protein-tyrosine phosphatase with two Src homology 2 (SH2) domains predominantly expressed in hematopoietic cells.
Sequence: DPPHLK-pY-LYLVVSDSK

MAGE-A1 Antigen (278-286); human- Cat# 62365
This peptide is amino acids 278 to 286 fragment of MAGE protein. It was found to be presented by HLA-A 0201 molecules on the surface of a human breast carcinoma cell line. MAGE-A1 tumor antigen can fully activate the mouse peptide-specific CTL lines to produce IFN-gamma. Tumor-specific shared antigens; such as those of the MAGE gene family; are expressed by tumors of different histological types.
Sequence: KVLEYVIKV

p53 (17-26)- Cat# 61375
This peptide is amino acids 17 to 26 fragment of p53; the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that contact the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development.
Sequence: ETFSDLWKLL

Myelopeptide-1 (MP-1)- Cat# 62362
This immunoregulatory peptide was originally isolated from the conditioned medium of porcine bone marrow cell cultures. Myelopeptide-1 blocks the T-suppressor activity. It enhances the number of antibody-forming cells in mouse spleen cells in vitro and increases antibody production in (CBAxC57B1/6)F1 mice in vivo.
Sequence: FLGFPT

Insulin Growth Factor Binding Protein 6 (IGFBP6); human- Cat# 62417
This decapeptide belongs to the human insulin growth factor (IGF) binding protein 6 (IGFBP6). There are six well-characterized IGFBPs. They are not only carriers of IGFs; but also modulators of their activity. IGFBPs are important in cell growth.
Sequence: APAVAEENPK

About AnaSpec, Inc.
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.

 
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Written by / Agency / Source: AnaSpec, Inc.

 
 

Availability: All Regions (Including Int'l)

 

Traffic Booster: [/] Quick Newswire Today Visibility Checker

 

Distribution / Indexing: [+]

 
 
# # #
 

 
  Your Banner Ad showing on ALL
Pharma/BioTech/Nutrition articles,
CATCH Visitors via Your Competitors Announcements!


AnaSpec Introduces Sixteen New Catalog Peptides

Company website links NOT available to basic submissions
It is OK to republish and/or LINK any newswire for any legitimate media purpose as long as you name Newswire Today and LINK as the source.
 
  Is this your article?
Activate ALL web links and social stream by Upgrading to Press Release PREMIUM Plan Now!

|
Publisher Contact: Albert Olson Hong 
1-408-452-5055 ping[.]anaspec.com
 
Newswire Today - PRZOOM / PRTODAY disclaims any content contained in this article. If you need/wish to contact the company who published the current release, you will need to contact them - NOT us. Issuers of articles are solely responsible for the accuracy of their content. Our complete disclaimer appears here.
IMPORTANT INFORMATION: Issuance, publication or distribution of this press release in certain jurisdictions could be subject to restrictions. The recipient of this press release is responsible for using this press release and the information herein in accordance with the applicable rules and regulations in the particular jurisdiction. This press release does not constitute an offer or an offering to acquire or subscribe for any AnaSpec, Inc. securities in any jurisdiction including any other companies listed or named in this release.

Pharma/BioTech/Nutrition via RSSAdd NewswireToday - PRZOOM Headline News to FeedBurner
Find who RetweetFollow @NewswireTODAY



Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!


Read Latest Articles From AnaSpec, Inc. / Company Profile


Read Pharma/BioTech/Nutrition Most Recent Related Newswires:

Frost & Sullivan Commends Nemaura for Developing Superior Transdermal Drug Delivery Technology Platforms, the Memspatch and Micropatch
Greenphire Sponsors Second Annual Clinical Trial Agreements, Investigator Payments and Fair Market Value Meeting
Genentech’s Gazyva Helped People with Previously Untreated Follicular Lymphoma Live Significantly Longer
BD Announces Adoption of Windows 10 ‘Internet of Things’ for the Pyxis™ ES System
Greenphire Named to Deloitte 2016 Technology Fast 500™
Genentech Showcases New Clinical Data Across a Variety of Blood Diseases at American Society of Hematology 2016 Annual Meeting
BD Collaborates with JDRF to Focus on Extended Wear Innovations for Insulin Infusion Delivery
BD Launches First Syringe Designed for Use with Humulin® R U-500 Insulin
MDxHealth Announces Unique CPT Code Awarded for ConfirmMDx from the American Medical Association
BD MAX™ Vaginal Panel Receives FDA Market Authorization to Detect Most Common Causes of Vaginal Infections
Greenphire Receives EU-US Privacy Shield Certification
The 2016 Georges Mathé Prize Recognizes Research on the Immunological Determinants of the Response to Breast Cancer Treatment
MDxHealth Announces Agreement with HIFU CLINIC Prostate Cancer Center for Distribution of SelectMDx in Poland
First Patient in Malaysia Receives TheraSphere™ Radioembolisation Therapy
FDA Approves Genentech’s Lucentis® (Ranibizumab Injection) Prefilled Syringe

Boost Your Social Network
& Crowdfunding Campaigns


LIFETIME SOCIAL MEDIA WALL
NewswireToday Celebrates 10 Years in Business


PREMIUM Members


Visit  JobsWare.com

Visit  La Bella Bakery Artisan Bakery Arizona





 
  ©2016 Newswire Today — Limelon Advertising, Co.
Home | About | Advertise/Pricing | Contact | Investors | Privacy/TOS | Sitemap | FRANCAIS
newswire, PR free press releases distribution service magazines engine news alert newsroom press room breaking news public relations articles company news alerts newswiredistribution ezine bizentrepreneur biznewstoday digital business report market search pr firms agencies reports distri-bution today investor relation successful internet entrepreneurs newswire distribution prtoday.com freenewswiredistribution asianewstoday bizwiretoday USA pr UK today - NOT affiliated with PRNewswire as we declined their partnership offer in 2013
 
PRTODAY & NewswireTODAY are NOT affiliated with USA TODAY (usatoday.com)