PRTODAY / NewswireToday Free press release distribution service network

Written by / Agency / Source: AnaSpec, Inc.

Check Ads Availability|e-mail Article


Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!

AnaSpec Introduces Nine New Catalog Peptides - AnaSpec introduced nine (9) new peptides for drug discovery research
AnaSpec Introduces Nine New Catalog Peptides

 

NewswireToday - /newswire/ - San Jose, CA, United States, 2007/09/24 - AnaSpec introduced nine (9) new peptides for drug discovery research.

   
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Today AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced nine (9) new peptides for drug discovery research.

Rat Renin FRET Substrate (5-FAM/QXL™520) - Cat# 62334
This renin FRET peptide is a specific substrate for rat renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by rat renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. The SensoLyte™ 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.

Peptide Substrate for Renin 520 Assay kit - Cat# 61872-01
This FRET peptide is a specific substrate for renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte™ 520 Renin Assay Kit; cat # 72040.

Rat Renin FRET Substrate (5-FAM/QXL™520) - Cat# 62334-01
This renin FRET peptide is a specific substrate for rat renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by rat renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. The SensoLyte™ 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.

[Glu1]-Fibrinopeptide B - Cat# 60501-1
Sequence: EGVNDNEEGFFSAR

Cyclo[-RGDyK(HiLyte Fluor™ 750)-] - Cat# 62333-1
Sequence: Cyclo[-RGDy-K(Hilyte Fluor 750)-]

Cyclo[-RGDyK(HiLyte Fluor™ 750)-] - Cat# 62333-01
Sequence: Cyclo[-RGDy-K(Hilyte Fluor 750)-]

Beta-Amyloid (1-42); Scrambled; 5-FAM labeled - Cat# 60892
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA

BPE-Conjugated-beta-Amyloid(1-40) - Cat# 60496
Sequence: B-Phycoerythrin-Conjugated-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

MAPS; Core; 8-Branch - Cat# 21006
Sequence: K4K2KA-NH2

About AnaSpec, Inc.
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.

 
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Written by / Agency / Source: AnaSpec, Inc.

 
 

Availability: All Regions (Including Int'l)

 

Traffic Booster: [/] Quick Newswire Today Visibility Checker

 

Distribution / Indexing: [+]

 
 
# # #
 

 
  Your Banner Ad showing on ALL
Pharma/BioTech/Nutrition articles,
CATCH Visitors via Your Competitors Announcements!


AnaSpec Introduces Nine New Catalog Peptides

Company website links NOT available to basic submissions
It is OK to republish and/or LINK any newswire for any legitimate media purpose as long as you name Newswire Today and LINK as the source.
 
  Is this your article?
Activate ALL web links and social stream by Upgrading to Press Release PREMIUM Plan Now!

|
Publisher Contact: Ping Yang 
1-408-452-5055 ping[.]anaspec.com
 
Newswire Today - PRZOOM / PRTODAY disclaims any content contained in this article. If you need/wish to contact the company who published the current release, you will need to contact them - NOT us. Issuers of articles are solely responsible for the accuracy of their content. Our complete disclaimer appears here.
IMPORTANT INFORMATION: Issuance, publication or distribution of this press release in certain jurisdictions could be subject to restrictions. The recipient of this press release is responsible for using this press release and the information herein in accordance with the applicable rules and regulations in the particular jurisdiction. This press release does not constitute an offer or an offering to acquire or subscribe for any AnaSpec, Inc. securities in any jurisdiction including any other companies listed or named in this release.

Pharma/BioTech/Nutrition via RSSAdd NewswireToday - PRZOOM Headline News to FeedBurner
Find who RetweetFollow @NewswireTODAY



Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!


Read Latest Articles From AnaSpec, Inc. / Company Profile


Read Pharma/BioTech/Nutrition Most Recent Related Newswires:

MDxHealth Signs Agreement with Lab21 to Make SelectMDx Liquid Biopsy Test Available in the United Kingdom
Greenphire Drives Global Site Adoption of Clinical Trial Payment Solutions
SelectMDx Chosen by Michigan Medicine as Pre-biopsy Diagnostic Tool in Groundbreaking US Prostate Cancer Risk Clinic
BTG Announces CE Mark Certification for DC Bead LUMI™ - The First Commercially Available Radiopaque Drug-Eluting Bead
Sartorius to Acquire Real-time Live-cell Analysis Pioneer and Leader Essen BioScience
Pyxis™ ES System to Help U.S. Department of Defense Advance Medication Safety and Patient Care
BTG Receives U.S. FDA 510(k) Clearance for EKOS® Control Unit 4.0
MDxHealth Announces Agreement with Istituto Diagnostico Varelli for Distribution of SelectMDx Throughout Central-South Italy
BD Veritor™ System Meets FDA’s New Performance Requirements for Rapid Influenza Antigen Detection Tests
Sub-Sahara Africa - Increase in Western Lifestyles Leads to Dire Need for Chronic Prescription Drugs Finds Frost & Sullivan
BD Initiates New Industry Alliance to Combat Rising Opioid Crisis
BTG and Society of Interventional Oncology to Explore Role of Minimally Invasive Therapies in Immuno-oncology
Ipsen to Acquire a Portfolio of Select Consumer Healthcare Products from Sanofi
BD Announces Early Access Program for BD Resolve™ Single-Cell Analysis Platform
Precision Medicine Unlocks the Future of Targeted Therapy in the Global Healthcare Industry Finds Frost & Sullivan

Boost Your Social Network
& Crowdfunding Campaigns


LIFETIME SOCIAL MEDIA WALL
NewswireToday Celebrates 10 Years in Business


PREMIUM Members


Visit  La Bella Bakery Artisan Bakery Arizona

Visit  BizJobs.com





 
  ©2017 Newswire Today — Limelon Advertising, Co.
Home | About | Advertise/Pricing | Contact | Investors | Privacy/TOS | Sitemap | FRANCAIS
newswire, PR free press releases distribution service magazines engine news alert newsroom press room breaking news public relations articles company news alerts newswiredistribution ezine bizentrepreneur biznewstoday digital business report market search pr firms agencies reports distri-bution today investor relation successful internet entrepreneurs newswire distribution prtoday.com freenewswiredistribution asianewstoday bizwiretoday USA pr UK today - NOT affiliated with PRNewswire as we declined their partnership offer in 2013
 
PRTODAY & NewswireTODAY are NOT affiliated with USA TODAY (usatoday.com)