PRTODAY / NewswireToday Free press release distribution service network

Written by / Agency / Source: AnaSpec, Inc.

Check Ads Availability|e-mail Article


Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!

AnaSpec Introduces Twenty-Six New Catalog Peptides - This week AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced twenty-six (26) new peptides for drug discovery research
AnaSpec Introduces Twenty-Six New Catalog Peptides

 

NewswireToday - /newswire/ - San Jose, CA, United States, 2007/06/15 - This week AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced twenty-six (26) new peptides for drug discovery research.

   
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

LL-37; Antimicrobial Peptide; human - Cat# 61302, 1 mg
Antimicrobial peptide LL-37; belonging to the cathelicidin family; is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defence against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells ; LL-37 is significantly resistant to proteolytic degradation in solution.
[LL-37, 37 aa]
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-
Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

mCRAMP; mouse - Cat# 61305, 1 mg
This cathelicidin-related antimicrobial peptide (mCRAMP) is a sole murine cathelicidin. The mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-
Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH

rCRAMP - Cat# 61306, 1 mg
This peptide is a rat homologue of the human cathelicidin LL-37. Rat cathelicidin-related antimicrobial peptide (rCRAMP) was identified in granulocytes; thymus; testis; lung; mouth mucosa; tongue; oesophagus; colon; caecum and small intestine. The rCRAMP peptide is present in specific CNS regions and may play a role in the innate immunity of the CNS. rCRAMP exhibits pro-healing activity in stomach.
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
H-Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-
Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln-OH

CAP-18; rabbit - Cat# 61307, 1 mg
This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immuno-compromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37); mice (mCRAMP); rats (rCRAMP); and sheep (SMAP29 and SMAP34).
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
H-Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-
Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr-OH

SMAP 29; Sheep Myeloid Antimicrobial Peptide 29 - Cat# 61308, 1 mg
This 29 amino acid sheep myeloid antimicrobial peptide 29 (SMAP 29) displays extremely high antimicrobial activity against Pseudomonas strains; other gram-negative bacteria; and multidrug-resistant pathogens. SMAP 29 is a broad-spectrum antibiotic cathelicidin; it is active in both low- and high-ionic-strength conditions; and induces significant morphological alterations in bacterial surfaces.
RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
H-Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-
Arg-Ile-Ala-Gly-OH

LL-37 pentamide - Cat# 61309, 1 mg
This synthetic peptide is a modification of the LL-37 cathelicidin peptide in which each aspartic acid of LL-37 is replaced by an asparagines; and each glutamic acid is replaced by a glutamine. LL-37 pentamide's anti-staphylococcal activity is greater than that of original LL-37 because multiple acidic residues of human LL-37 reduce its efficacy against Staphylococci.
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
H-Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-
Asn-Phe-Phe-Arg-Asn-Leu-Val-Pro-Arg-Thr-Gln-Ser-OH

OV-1; Sheep - Cat# 61310, 1 mg
This alpha-helical antimicrobial OV-1 ovispirin peptide is derived from SMAP29 peptide. It was found to inhibit several antibiotic-resistant bacterial strains including mucoid and nonmucoid Pseudomonas aeruginosa.
KNLRRIIRKIIHIIKKYG
H-Lys-Asn-Leu-Arg-Arg-Ile-Ile-Arg-Lys-Ile-Ile-His-Ile-Ile-Lys-Lys-Tyr-Gly-OH

OV-2; Sheep - Cat# 61311, 1 mg
This alpha-helical 14-amino-acid SMAP29 derivative was found to inhibit mucoid and nonmucoid Pseudomona. aeruginosa strains.
LRRIIRKIIHIIKK-NH2
H-Leu-Arg-Arg-Ile-Ile-Arg-Lys-Ile-Ile-His-Ile-Ile-Lys-Lys-NH2

Stromal Target Antigen - Cat# 61297, 1 mg
This peptide can be the target for the antigen-specific T cells that can also indirectly eliminate the cancer antigen-loss variant cells by eliminating the tumor stroma that cross-presented on this target antigen. This peptide is a candidate anti-cancer drug.
SIYYYRYGL
H-Ser-Ile-Tyr-Tyr-Tyr-Arg-Tyr-Gly-Leu-OH

[-2] pPSA; Prostate-Specific Antigen; truncated - Cat# 61271, 1 mg
This peptide is a truncated form of precursor Prostate-Specific Antigen (pPSA). The peptide was identified in prostate tumor extracts consisting of PSA with a serine-arginine pro leader peptide ([-2]pPSA) instead of the normally expressed 7 amino acid pro leader peptide. The antigen is also enriched in cancer cell secretions. This form of pPSA is enzymatically inactive.
SRIVGGWECEK
H-Ser-Arg-Ile-Val-Gly-Gly-Trp-Glu-Cys-Glu-Lys-OH

[APLILSR]pPSA - Cat# 61272, 1 mg
This form of the pro Prostate-Specific Antigen (pPSA) contains the pro leader peptide and N-terminal tryptic fragment of PSA. The pro leader peptide; APLILSR is necessary for secretion from mammalian cells and is removed extracellularly to produce active; mature PSA.
APLILSRIVGGWECEK
H-Ala-Pro-Leu-Ile-Leu-Ser-Arg-Ile-Val-Gly-Gly-Trp-Glu-Cys-Glu-Lys-OH

G154; gp100 (154-162) - Cat# 61274, 1 mg
This peptide was isolated directly from MHC-associated HLA-A*0201 molecules of human melanoma cells. G154 peptide amino acids 154 to 162 is a naturally processed epitope for HLA-A*0201-restricted melanoma-reactive cytotoxic T lymphocytes (CTLs). It appears to be the most abundant among the other peptides from the gp100 group at the cell surface.
KTWGQYWQV
H-Lys-Thr-Trp-Gly-Gln-Tyr-Trp-Gln-Val-OH

G209-2M; gp100 (209-217) - Cat# 61277, 1 mg
This modified gp100 peptide amino acids 209 to 217 is a MHC-associated HLA-A2.1-restricted epitope derived from melanoma antigene. It can be processed; presented; and recognized by T cells. Alteration of the G209 peptide to G209-2M at the second amino acid changing threonine to a methionine was found to increase the affinity for MHC-associated HLA-A2.1 resulting in enhanced induction of T cells reactive to native gp100
IMDQVPFSV
H-Ile-Met-Asp-Gln-Val-Pro-Phe-Ser-Val-OH

G209; gp100 (209-217) - Cat# 61276, 1 mg
This peptide gp100 amino acids 209 to 217 is the most well characterized and most commonly used epitope in melanoma studies. G209 sequence was isolated directly from MHC-associated HLA-A*0201 molecules of human melanoma cells.
ITDQVPFSV
H-Ile-Thr-Asp-Gln-Val-Pro-Phe-Ser-Val-OH

G280-9V; gp100(280-288) Lys(biotin) - Cat# 61278, 1 mg
This modified G280 melanoma antigen gp100; amino acids 280 to 288; is a high affinity epitope for MHC-associated HLA- A. Immunization with this peptide elicits CD8+ immunity and induces Ag-specific cytotoxic T lymphocytes (CTL). It has higher class I MHC-binding affinity than original G280-9 peptide. This peptide is biotinylated at the side chain of lysine at the C-terminus.
YLEPGPVTV-K(Biotin)
H-Tyr-Leu-Glu-Pro-Gly-Pro-Val-Thr-Val-Lys(Biotin)

G280-9; gp100 (280-288); Lys (biotin) - Cat# 61280, 1 mg
This is a biotinylated form of the G280-9 peptide; a common melanoma gp100 epitope restricted by MHC-associated HLA-A2. The G280-9 sequence is unique because it could be recognized by cytotoxic T lymphocytes at very low concentrations; however it shows low total immunogenic.

 
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Written by / Agency / Source: AnaSpec, Inc.

 
 

Availability: All Regions (Including Int'l)

 

Traffic Booster: [/] Quick Newswire Today Visibility Checker

 

Distribution / Indexing: [+]

 
 
# # #
 

 
  Your Banner Ad showing on ALL
Pharma/BioTech/Nutrition articles,
CATCH Visitors via Your Competitors Announcements!


AnaSpec Introduces Twenty-Six New Catalog Peptides

Company website links NOT available to basic submissions
It is OK to republish and/or LINK any newswire for any legitimate media purpose as long as you name Newswire Today and LINK as the source.
 
  Is this your article?
Activate ALL web links and social stream by Upgrading to Press Release PREMIUM Plan Now!

|
Publisher Contact: Ping Yang 
408-452-5055 ping[.]anaspec.com
 
Newswire Today - PRZOOM / PRTODAY disclaims any content contained in this article. If you need/wish to contact the company who published the current release, you will need to contact them - NOT us. Issuers of articles are solely responsible for the accuracy of their content. Our complete disclaimer appears here.
IMPORTANT INFORMATION: Issuance, publication or distribution of this press release in certain jurisdictions could be subject to restrictions. The recipient of this press release is responsible for using this press release and the information herein in accordance with the applicable rules and regulations in the particular jurisdiction. This press release does not constitute an offer or an offering to acquire or subscribe for any AnaSpec, Inc. securities in any jurisdiction including any other companies listed or named in this release.

Pharma/BioTech/Nutrition via RSSAdd NewswireToday - PRZOOM Headline News to FeedBurner
Find who RetweetFollow @NewswireTODAY



Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!


Read Latest Articles From AnaSpec, Inc. / Company Profile


Read Pharma/BioTech/Nutrition Most Recent Related Newswires:

Greenphire Sponsors Second Annual Clinical Trial Agreements, Investigator Payments and Fair Market Value Meeting
Genentech’s Gazyva Helped People with Previously Untreated Follicular Lymphoma Live Significantly Longer
BD Announces Adoption of Windows 10 ‘Internet of Things’ for the Pyxis™ ES System
Greenphire Named to Deloitte 2016 Technology Fast 500™
Genentech Showcases New Clinical Data Across a Variety of Blood Diseases at American Society of Hematology 2016 Annual Meeting
BD Collaborates with JDRF to Focus on Extended Wear Innovations for Insulin Infusion Delivery
BD Launches First Syringe Designed for Use with Humulin® R U-500 Insulin
MDxHealth Announces Unique CPT Code Awarded for ConfirmMDx from the American Medical Association
BD MAX™ Vaginal Panel Receives FDA Market Authorization to Detect Most Common Causes of Vaginal Infections
Greenphire Receives EU-US Privacy Shield Certification
The 2016 Georges Mathé Prize Recognizes Research on the Immunological Determinants of the Response to Breast Cancer Treatment
MDxHealth Announces Agreement with HIFU CLINIC Prostate Cancer Center for Distribution of SelectMDx in Poland
First Patient in Malaysia Receives TheraSphere™ Radioembolisation Therapy
FDA Approves Genentech’s Lucentis® (Ranibizumab Injection) Prefilled Syringe
BTG and Mirada Medical Announce CE Mark Certification for Simplicit90Y Dosimetry Software in Europe

Boost Your Social Network
& Crowdfunding Campaigns


LIFETIME SOCIAL MEDIA WALL
NewswireToday Celebrates 10 Years in Business


PREMIUM Members


Visit  La Bella Bakery Artisan Bakery Arizona

Visit  Triggr & Bloom





 
  ©2016 Newswire Today — Limelon Advertising, Co.
Home | About | Advertise/Pricing | Contact | Investors | Privacy/TOS | Sitemap | FRANCAIS
newswire, PR free press releases distribution service magazines engine news alert newsroom press room breaking news public relations articles company news alerts newswiredistribution ezine bizentrepreneur biznewstoday digital business report market search pr firms agencies reports distri-bution today investor relation successful internet entrepreneurs newswire distribution prtoday.com freenewswiredistribution asianewstoday bizwiretoday USA pr UK today - NOT affiliated with PRNewswire as we declined their partnership offer in 2013
 
PRTODAY & NewswireTODAY are NOT affiliated with USA TODAY (usatoday.com)