PRTODAY / NewswireToday Free press release distribution service network

Written by / Agency / Source: AnaSpec, Inc.

Check Ads Availability|e-mail Article


Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!

AnaSpec Introduces Fifty-Five New Catalog Peptides - This week AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced fifty-five new peptides for drug discovery research
AnaSpec Introduces Fifty-Five New Catalog Peptides

 

NewswireToday - /newswire/ - San Jose, CA, United States, 2007/02/07 - This week AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced fifty-five new peptides for drug discovery research.

   
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Peptides/Amyloid Peptides
Beta-Amyloid (1-15) (Cat# 61798)
Sequence: DAEFRHDSGYEVHHQ
Sequence (3-Letter): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH

Beta-Amyloid (7-22) (Cat# 61803)
This beta Amyloid 7 to 22 amino acid residues peptide was utilized in studies of the catabolism of the b-amyloid peptides.
Sequence: DSGYEVHHQKLVFFAE
Sequence (3-Letter): H-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-OH
Reference(s): Ghiso, J. et al. J. Biol. Chem. 279, 45897 (2004).

Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-01)
Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (3-Letter): Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-
Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-05)
Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (3-Letter): Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-
Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-1)
Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (3-Letter): Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-
Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Beta-Amyloid (1-34) (Cat# 61799)
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Sequence (3-Letter): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-
Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-OH

Peptides/Bacterial Peptides
P69 (522-534), M. leprae (Cat# 61688)
A Mycobacteria leprae heat shock protein (M. leprae HSP65)-specific epitope.
Sequence: PEKTAAPASDPTG
Sequence (3-Letter): H-Pro-Glu-Lys-Thr-Ala-Ala-Pro-Ala-Ser-Asp-Pro-Thr-Gly-OH
Reference(s): Mustafa, A. et al. Infect. Immun. 67, 5683 (1999).

Peptides/Ghrelin Peptides
Biotin-Ghrelin, bovine (Cat# 61714)
This is a biotinylated form of the bovine grhelin peptide.
Sequence: GS-S(n-octanoylated)-FLSPEHQKLQRKEAKKPSGRLKPR
Sequence (3-Letter): H-Gly-Ser-Ser(n-octanoylated)-Phe-Leu-Ser-Pro-Glu-His-Gln-Lys-Leu-Gln-Arg-Lys-Glu-Ala-Lys-Lys-Pro-
Ser-Gly-Arg-Leu-Lys-Pro-Arg-OH
Reference(s): ThidarMyint, H. et al. J. Endocrinol. 189, 655 (2006); Gauna, C. et al. J. Clin. Endo. Metab. 90, 1055 (2005); Currie, P. et al. Am. J. Physiol. Regul. Integr. Comp. Physiol. 289, R353 (2005); Arvat, E. et al. J. Clin. Endo. Metab 86, 1169 (2001).

Peptides/Protein Phosphorylation Related Peptides
(pS8, pS13) Eucariotic Translation Initiation Factor 2B, eIF2B (Cat# 61739)
This is an eukaryotic protein synthesis initiation factor 2B (elF2B), the double phosphorylated amidated peptide. Dephosphorylation of this peptide by insulin signaling and glycogen synthase kinase 3 (GSK3) inhibition leads to its activation. The references below correspond to the single phosphorylated peptide.
Sequence: RRAAEELDpSRAGpSPQL
Sequence (3-Letter): H-Arg-Arg-Ala-Ala-Glu-Glu-Leu-Asp-pSer-Arg-Ala-Gly-pSer-Pro-Gln-Leu-OH
Reference(s): Frame, S. et al. Mol. Cell. 7, 1321 (2001); Oreña, S. et al. J. Biol. Chem. 275, 15765 (2000); Kang Ho Kim, et al. J. Biol. Chem. 279, 51999 (2004); Niloulina, S. et al. Diabetes 51, 2190 (2002); Brady, M. et al. J. Biol. Chem. 273, 14063 (1998).

Gycogen Synthase-derived peptide, phosphorylated, TAMRA-labeled (Cat# 61725)
A TAMRA-labeled phosphorylated Glycogen synthese derived peptide (Ab/Em = 544/572 nm). This peptide, which is phosphorylated at the serine residue and obtained from the N terminal of Glycogen synthase protein sequence, is a substrate for MAPKAPK2 (Mitogen activated protein kinase).
Sequence: 5-TAMRA-KKLNRTL-pS-VA-OH
Sequence (3-Letter): 5-TAMRA-Phe-Phe-Leu-Asn-Arg-Thr-Leu-pSer-Val-Ala-OH
Reference(s): Stokoe, D. et al. Biochem. J. 296, 846 (1993).

Histone H1-derived peptide, FAM-labeled (Cat# 61762)
This is a FAM-labeled Histone H1-derived peptide (Ab/Em = 494/521 nm). Histone H1-derived peptide phosphorylated by protein kinase A is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.
Sequence: 5-FAM-GGGPATPKKAKKL-OH
Sequence (3-Letter): 5-FAM-Gly-Gly-Gly-Pro-Ala-Thr-Pro-lys-lys-Ala-Lys-Lys-Leu-OH
Reference(s): Pomerant, A. et al. Proc. Natl. Acad. Sci. USA 74, 4261 (1977).

Cdc25C-derived peptide (Cat# 61726)
This peptide is used as a substrate for CHK (checkpoint kinase) 1 and 2 in in-vitro kiase assays.
Sequence: 5-FAM-VSRSGLYRSPSMPENLNRPR-OH
Sequence (3-Letter): 5-FAM-Val-Ser-Arg-Ser-Gly-Leu-Tyr-Arg-Ser-Pro-Ser-Met-Pro-Glu-Asn-Leu-Asn-Arg-Pro-Arg-OH
Reference(s): O'Neill, T. et al. Biol. Chem 277, 16102 (2002).

EGFR-derived peptide (Cat# 61790)
This EGFR derived peptide is a potential substrate for EGFR (Epidermal Growth Factor Receptor) protein tyrosine kinase.
Sequence: LVEPLTPSGEAPNQK-OH
Sequence (3-Letter): H-Leu-Val-Glu-Pro-Leu-Thr-Pro-Ser-Gly-Glu-Ala--Pro-Asn--Gln-Lys-OH
Reference(s): Bishayee, A. et al. Mol. Biol. Cell. 10, 671 (1995).

CK1tide (Cat# 61767)
CK1tide is obtained from inhibitor-2 of protein phosphatase-1 with modifications that makes it a good substrate for casein kinase I ( Km = 172 uM but a poor substrate for casein kinase II.
Sequence: HAAIGDDDDAYSITS-NH2
Sequence (3-Letter): H-His-Ala-Ala-Ile-Gly-Asp-Asp-Asp-Asp-Ala-Tyr-Ser-Ile-Thr-Ser-NH2
Reference(s): Marin, O. et al. Biochem. Biophys. Res. Commun. 198, 898 (1994).

PLM derived peptide (Cat# 61780)
PLM derived peptide is a substrate for PKC (protein kinase C), with insulin induced phosphorylation in skeletal muscle in-situ ocurring at Ser-63 and Ser-68. Synthetic PLM(58-72) can serve as an inhibitor of PLM phosphorylation.
Sequence: IRRLSTRRR-OH
Sequence (3-Letter): H-Ile-Arg-Arg-Leu-Ser-Thr-Arg-Arg-Arg-OH
Reference(s): Matsudaira, P. et al. J. Biol. Chem. 262, 11955 (1987)

ADR1-derived peptide (Cat# 61784)
ADR1 derived peptide is a substrate for cAMP dependent protein kinase and for two members of the CaM Kinase family, CaMKII and Ca2+/CaM dependent kinase 4 (CaMK IV) which regulate the synthesis of glucose-repressible isozyme of alcohol dehydrogenase.
Sequence: LKKLTRRASFSGQ-OH
Sequence (3-Letter): H-Leu-Lys-Lys-Leu-Thr-Arg-Arg-Ala-Ser-Phe-Ser-Gly-Gln-OH
Reference(s): Kemp, B. et al. Protein Kinases. 238, 1726 (1987).

p38tide, FAM-labeled (Cat# 61754)
A FAM-labeled p38tide (Ab/Em = 494/521 nm). This peptide produced in Escherichia Coli, is readily phosphorylated by p38SAPK in in-vitro analysis.
Sequence: 5-FAM-IPTTPITTTYFFFK-NH2
Sequence (3-Letter): 5-FAM-Ile-Pro-Thr-Thr-Pro-Ile-Thr-Thr-Thr-Tyr-Phe-Phe-Phr-Lys-NH2
Reference(s): Boros, DL. et al. Clin. Microbial Rev. 2, 250 (1989)

p38tide, TAMRA-labeled (Cat# 61753)
This peptide produced in Escherichia Coli, is readily phosphorylated by p38SAPK in in-vitro analysis.
Sequence: 5-TAMRA-IPTTPITTTYFFFK-NH2
Sequence (3-Letter): 5-TAMRA-Ile-Pro-Thr-Thr-Pro-Ile-Thr-Thr-Thr-Tyr-Phe-Phe-Phr-Lys-NH2
Reference(s): Boros, DL. et al. Clin. Microbial Rev. 2, 250 (1989)

p38tide (Cat# 61752)
Synapsin I derived peptide is a neuron specific substrate for cAMP dependent and Ca2+/calmodulin dependent protein kinase. It plays an important role in the mechanism involved in neuron transmitter disease

 
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Written by / Agency / Source: AnaSpec, Inc.

 
 

Availability: All Regions (Including Int'l)

 

Traffic Booster: [/] Quick Newswire Today Visibility Checker

 

Distribution / Indexing: [+]

 
 
# # #
 

 
  Your Banner Ad showing on ALL
Pharma/BioTech/Nutrition articles,
CATCH Visitors via Your Competitors Announcements!


AnaSpec Introduces Fifty-Five New Catalog Peptides

Company website links NOT available to basic submissions
It is OK to republish and/or LINK any newswire for any legitimate media purpose as long as you name Newswire Today and LINK as the source.
 
  Is this your article?
Activate ALL web links and social stream by Upgrading to Press Release PREMIUM Plan Now!

|
Publisher Contact: Debra Thai 
408-452-5055 service[.]anaspec.com
 
Newswire Today - PRZOOM / PRTODAY disclaims any content contained in this article. If you need/wish to contact the company who published the current release, you will need to contact them - NOT us. Issuers of articles are solely responsible for the accuracy of their content. Our complete disclaimer appears here.
IMPORTANT INFORMATION: Issuance, publication or distribution of this press release in certain jurisdictions could be subject to restrictions. The recipient of this press release is responsible for using this press release and the information herein in accordance with the applicable rules and regulations in the particular jurisdiction. This press release does not constitute an offer or an offering to acquire or subscribe for any AnaSpec, Inc. securities in any jurisdiction including any other companies listed or named in this release.

Pharma/BioTech/Nutrition via RSSAdd NewswireToday - PRZOOM Headline News to FeedBurner
Find who RetweetFollow @NewswireTODAY



Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!


Read Latest Articles From AnaSpec, Inc. / Company Profile


Read Pharma/BioTech/Nutrition Most Recent Related Newswires:

Genentech’s Gazyva Helped People with Previously Untreated Follicular Lymphoma Live Significantly Longer
BD Announces Adoption of Windows 10 ‘Internet of Things’ for the Pyxis™ ES System
Greenphire Named to Deloitte 2016 Technology Fast 500™
Genentech Showcases New Clinical Data Across a Variety of Blood Diseases at American Society of Hematology 2016 Annual Meeting
BD Collaborates with JDRF to Focus on Extended Wear Innovations for Insulin Infusion Delivery
BD Launches First Syringe Designed for Use with Humulin® R U-500 Insulin
MDxHealth Announces Unique CPT Code Awarded for ConfirmMDx from the American Medical Association
BD MAX™ Vaginal Panel Receives FDA Market Authorization to Detect Most Common Causes of Vaginal Infections
Greenphire Receives EU-US Privacy Shield Certification
The 2016 Georges Mathé Prize Recognizes Research on the Immunological Determinants of the Response to Breast Cancer Treatment
MDxHealth Announces Agreement with HIFU CLINIC Prostate Cancer Center for Distribution of SelectMDx in Poland
First Patient in Malaysia Receives TheraSphere™ Radioembolisation Therapy
FDA Approves Genentech’s Lucentis® (Ranibizumab Injection) Prefilled Syringe
BTG and Mirada Medical Announce CE Mark Certification for Simplicit90Y Dosimetry Software in Europe
FDA Grants Priority Review to Genentech’s Lucentis® (Ranibizumab Injection) Supplemental Biologics License Application

Boost Your Social Network
& Crowdfunding Campaigns


LIFETIME SOCIAL MEDIA WALL
NewswireToday Celebrates 10 Years in Business


PREMIUM Members


Visit  JobsWare.com

Visit  La Bella Bakery Artisan Bakery Arizona





 
  ©2016 Newswire Today — Limelon Advertising, Co.
Home | About | Advertise/Pricing | Contact | Investors | Privacy/TOS | Sitemap | FRANCAIS
newswire, PR free press releases distribution service magazines engine news alert newsroom press room breaking news public relations articles company news alerts newswiredistribution ezine bizentrepreneur biznewstoday digital business report market search pr firms agencies reports distri-bution today investor relation successful internet entrepreneurs newswire distribution prtoday.com freenewswiredistribution asianewstoday bizwiretoday USA pr UK today - NOT affiliated with PRNewswire as we declined their partnership offer in 2013
 
PRTODAY & NewswireTODAY are NOT affiliated with USA TODAY (usatoday.com)